The domain within your query sequence starts at position 1 and ends at position 70; the E-value for the BTB_2 domain shown below is 1.3e-13.
MLAHMFKDKGVWGNKQDHRGAFLIDRSPEYFEPILNYLRHGQLIVNDGINLLGVLEEARF FGIDSLIEHL
BTB_2 |
![]() |
---|
PFAM accession number: | PF02214 |
---|---|
Interpro abstract (IPR003131): | This domain can be found at the N terminus of voltage-gated potassium channel proteins, where represents a cytoplasmic tetramerisation domain (T1) involved in assembly of alpha-subunits into functional tetrameric channels [ (PUBMED:9886290) ]. This domain can also be found in proteins that are not potassium channels, like KCTD1 (potassium channel tetramerisation domain-containing protein 1). KCTD1 is though to be a nuclear protein that functions as a transcriptional repressor. In KCTD1, the T1-type BTB domain mediates homomeric protein-protein interactions [ (PUBMED:18358072) (PUBMED:19115315) ]. |
GO process: | protein homooligomerization (GO:0051260) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BTB_2