SMART: Pfam domain BUD22

The domain within your query sequence starts at position 338 and ends at position 440; the E-value for the BUD22 domain shown below is 1.1e-14.

VRNDKHRPIPEARKFESVFFHSLAGPKSSRRDPREQAPKNKAPDFPENEPPVKKQFTKSA
YRGFESVKQTMQAPLHPSWEASRRRKEQQSKIAVFQGKKITFD

BUD22

PFAM accession number:	PF09073
Interpro abstract (IPR015158):	This entry represents a domain found in the fungal Bud22 protein and the animal SRFB1 (serum response factor-binding protein 1) protein. Budding yeast Bud22 is required for rRNA maturation and ribosomal subunit biogenesis [ (PUBMED:20498295) (PUBMED:19806183) ]. SRFB1 may be involved in regulating transcriptional activation of cardiac genes during the aging process and may play a role in biosynthesis and/or processing of SLC2A4 in adipose cells [ (PUBMED:15492011) (PUBMED:16647043) ].

PFAM accession number:

PF09073

Interpro abstract (IPR015158):

This entry represents a domain found in the fungal Bud22 protein and the animal SRFB1 (serum response factor-binding protein 1) protein. Budding yeast Bud22 is required for rRNA maturation and ribosomal subunit biogenesis [ (PUBMED:20498295) (PUBMED:19806183) ]. SRFB1 may be involved in regulating transcriptional activation of cardiac genes during the aging process and may play a role in biosynthesis and/or processing of SLC2A4 in adipose cells [ (PUBMED:15492011) (PUBMED:16647043) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BUD22