The domain within your query sequence starts at position 27 and ends at position 241; the E-value for the Barttin domain shown below is 5.2e-110.

SHDRPQVYGTFYAMGSVMVIGGVIWSMCQCYPKITFVPADSDFQGILSPKALSLLETGLS
EVKSPQPPYVRLWEEAAYDQSLPDFTHIQMKVMGYSEDPRPLLAPELKTGASSVREGEPR
TAQAWMEAPVVVHRGSDENEGEKSHSQSSPSVGPQGSAPLASFHDDLDVGSSEGSSLQPS
PNRDEPHRQVPWASRGPLDRFSDFALIDDTPTSED

Barttin

 Barttin
PFAM accession number:PF15462
Interpro abstract (IPR029181):

Barttin is a beta-subunit for ClC-Ka and ClC-Kb chloride channels, with which it co-localises in basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear [ (PUBMED:11734858) (PUBMED:12111250) ]. Mutations in Barttin gene cause Bartter syndrome 4A (BS4A), which is an autosomal recessive disorder characterised by impaired salt re-absorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria.

GO process:chloride transport (GO:0006821)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Barttin