The domain within your query sequence starts at position 531 and ends at position 623; the E-value for the BetaGal_dom4_5 domain shown below is 4.3e-10.
ASDEGHLDGRSTSNSSDLILPTFYVGNFSIPSGIPDLPQDTFIQFPGWSKGQVWINGFNL GRYWPTMGPQKTLFVPRNILTTSAPNNITVLEL
BetaGal_dom4_5 |
 |
|---|
| PFAM accession number: | PF13364 |
|---|---|
| Interpro abstract (IPR025300): | This domain is found in beta-galactosidase enzymes, mainly from the glycosyl hydrolase 35 family. It has a jelly roll fold [ (PUBMED:15491613) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BetaGal_dom4_5