The domain within your query sequence starts at position 231 and ends at position 375; the E-value for the Beta_elim_lyase domain shown below is 3.2e-6.

KMREIVGWSNKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSH
YSIKKAGAALGFGTDNVILIKCNERGKIIPADLEAKILDAKQKGYVPLYVNATAGTTVYG
AFDPIQEIADICEKYNLWLHVDAAW

Beta_elim_lyase

 Beta_elim_lyase
PFAM accession number:PF01212
Interpro abstract (IPR001597):

This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases. It is involved in the degradation of amino acids. The glycine cleavage system is composed of four proteins: P, T, L and H. In Bacillus subtilis, the P 'protein' is an heterodimer of two subunits. The glycine cleavage system catalyses the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein

GO process:cellular amino acid metabolic process (GO:0006520)
GO function:lyase activity (GO:0016829)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Beta_elim_lyase