The domain within your query sequence starts at position 1 and ends at position 98; the E-value for the BicD domain shown below is 1.2e-69.
AEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDE MQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEF
BicD |
---|
PFAM accession number: | PF09730 |
---|---|
Interpro abstract (IPR018477): | Bicaudal-D (BicD) is a family of motor adaptor proteins consist of three coiled-coiled domains. BicD plays an essential for the correct localization of maternal mRNAs in Drosophila's oocyte [ (PUBMED:17827179) ] and functions as a regulator of the Golgi to ER retrograde transport in mammalian cells [ (PUBMED:19018277) ]. BicD was suggested to be a linker bridging cargo and dynein and have roles in the regulation of cargo motility [ (PUBMED:19754453) ]. It also functions as a novel regulator of neurotrophin (NT) signaling [ (PUBMED:28215293) ]. |
GO function: | dynein complex binding (GO:0070840), cytoskeletal anchor activity (GO:0008093) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BicD