The domain within your query sequence starts at position 16 and ends at position 141; the E-value for the Bile_Hydr_Trans domain shown below is 7.4e-44.
DEPLSIAVRGLAPEQPVTLRTALRDEKGALFRAHARYRADSHGELDLARTPALGGSFSGL EPMGLLWAMEPDRPFWRLIKRDVQTPFVVELEVLDGHEPDGGRLLARAVHERHFMAPGVR RVPVRE
Bile_Hydr_Trans |
---|
PFAM accession number: | PF04775 |
---|---|
Interpro abstract (IPR006862): | This entry presents the N-termini of acyl-CoA thioester hydrolase and bile acid-CoA:amino acid N-acetyltransferase (BAAT) [ (PUBMED:11673457) ]. This region is not thought to contain the active site of either enzyme. Thioesterase isoforms have been identified in peroxisomes, cytoplasm and mitochondria, where they are thought to have distinct functions in lipid metabolism [ (PUBMED:10567408) ]. For example, in peroxisomes, the hydrolase acts on bile-CoA esters [ (PUBMED:11673457) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bile_Hydr_Trans