The domain within your query sequence starts at position 1 and ends at position 93; the E-value for the BioT2 domain shown below is 1.7e-36.

MKRAKHPSNISVKLTSVPELPYNKGLLNSSPKPKEKHNAKSTPDKIEPMVIRSPPTGESI
VRYALPIPSTMMKDLVSDAEMVRRIATNMKMIL

BioT2

BioT2
PFAM accession number:PF15368
Interpro abstract (IPR029272):

This entry represents the coiled-coil domain-containing protein 7 (also known as BioT2), which is a testis-specific protein found abundantly in five types of murine cancer cell lines. It may play a role in testis development and tumourigenesis [ (PUBMED:1927747) (PUBMED:19447332) (PUBMED:20704574) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BioT2