The domain within your query sequence starts at position 57 and ends at position 131; the E-value for the Biotin_lipoyl domain shown below is 1.8e-21.
IKVLMPSLSPTMEQGNIVKWLRKEGEAVSAGDSLCEIETDKAVVTLDANDDGILAKIVVE EGAKNIQLGSLIALM
Biotin_lipoyl |
![]() |
---|
PFAM accession number: | PF00364 |
---|---|
Interpro abstract (IPR000089): | The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid. Biotin plays a catalytic role in some carboxyl transfer reactions and is covalently attached, via an amide bond, to a lysine residue in enzymes requiring this coenzyme [ (PUBMED:1526981) ]. E2 acyltransferases have an essential cofactor, lipoic acid, which is covalently bound via an amide linkage to a lysine group [ (PUBMED:1825611) ]. The lipoic acid cofactor is found in a variety of proteins that include, H-protein of the glycine cleavage system (GCS), mammalian and yeast pyruvate dehydrogenases and fast migrating protein (FMP) (gene acoC) from Ralstonia eutropha (Alcaligenes eutrophus). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Biotin_lipoyl