The domain within your query sequence starts at position 140 and ends at position 430; the E-value for the Bystin domain shown below is 1.1e-144.
PPVRRTLADIIMEKLTEKQTEVETVMSEVSGFPMPQLDPRVLEVYRGVREVLCKYRSGKL PKAFKVIPALSNWEQILYVTEPEAWTAAAMYQATRIFASNLKERMAQRFYNLVLLPRVRD DIAEYKRLNFHLYMALKKALFKPGAWFKGILIPLCESGTCTLREAIIVGSIITKCSIPVL HSSAAMLKIAEMEYSGANSIFLRLLLDKKYALPYRVLDALVFHFLAFRTEKRQLPVLWHQ CLLTLAQRYKADLATEQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVED
Bystin |
![]() |
---|
PFAM accession number: | PF05291 |
---|---|
Interpro abstract (IPR007955): | Trophinin and tastin form a cell adhesion molecule complex that potentially mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of implantation. Trophinin and tastin bind to an intermediary cytoplasmic protein called bystin. Bystin may be involved in implantation and trophoblast invasion because bystin is found with trophinin and tastin in the cells at human implantation sites and also in the intermediate trophoblasts at invasion front in the placenta from early pregnancy [ (PUBMED:9560222) ]. This family also includes the Saccharomyces cerevisiae protein ENP1. ENP1 is an essential protein in S. cerevisiae and is localised in the nucleus [ (PUBMED:9034325) ]. It is thought that ENP1 plays a direct role in the early steps of rRNA processing as enp1 defective S. cerevisiae cannot synthesise 20S pre-rRNA and hence 18S rRNA, which leads to reduced formation of 40S ribosomal subunits [ (PUBMED:12527778) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bystin