The domain within your query sequence starts at position 597 and ends at position 738; the E-value for the C2-C2_1 domain shown below is 5.8e-61.
TIHLERGENLFEIHINKVTFSSEVLRASGDKELVTFCTYAFYDFELQTTPIVRGLYPEYN FTSQYLVHVNDLFLQYIQKNTVTLELHQAHSTDYETIAACQLRFHEILEKSGRIFCTTSL VGTKGDIPNFGTVEYWFRLRVP
C2-C2_1 |
![]() |
---|
PFAM accession number: | PF11618 |
---|---|
Interpro abstract (IPR021656): | This domain is the first, more N-terminal, C2 domain on X-linked retinitis pigmentosa GTPase regulator-interacting proteins, or RPGR-interacting proteins [ (PUBMED:17558409) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry C2-C2_1