The domain within your query sequence starts at position 13 and ends at position 106; the E-value for the C6_DPF domain shown below is 3.2e-41.
FECQLCALSAPYSYVGQKPPDTQAVVLLEESYIMKDPFSSDKARFLVLGSRCSVCSRLVC VGPDCSLFYSKRVCLPCVQENMSAFPQEIQQDVE
C6_DPF |
![]() |
---|
PFAM accession number: | PF10170 |
---|---|
Interpro abstract (IPR018785): | This entry represents the N-terminal approximately 100 amino acids of a family of proteins found in a range of organisms, including human, chicken and Drosophila [ (PUBMED:10591208) (PUBMED:15642098) (PUBMED:12537572) ]. It contains between six and eight highly conserved cysteine residues and a characteristic DPF sequence motif. One member is putatively named as receptor for egg jelly protein but this could not confirmed. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry C6_DPF