SMART: Pfam domain C6

The domain within your query sequence starts at position 13 and ends at position 109; the E-value for the C6_DPF domain shown below is 1.6e-53.

FECQLCALSAPYSYVGQKPPDTQAVVLLEESYIMKDPFSSDKARFLVLGSRCSVCSRLVC
VGPDCSLFYSKRVCLPCVQENMSAFPQEIQQDVEKRK

C6_DPF

PFAM accession number:	PF10170
Interpro abstract (IPR018785):	This entry represents the N-terminal approximately 100 amino acids of a family of proteins found in a range of organisms, including human, chicken and Drosophila [ (PUBMED:10591208) (PUBMED:15642098) (PUBMED:12537572) ]. It contains between six and eight highly conserved cysteine residues and a characteristic DPF sequence motif. One member is putatively named as receptor for egg jelly protein but this could not confirmed.

PFAM accession number:

PF10170

Interpro abstract (IPR018785):

This entry represents the N-terminal approximately 100 amino acids of a family of proteins found in a range of organisms, including human, chicken and Drosophila [ (PUBMED:10591208) (PUBMED:15642098) (PUBMED:12537572) ]. It contains between six and eight highly conserved cysteine residues and a characteristic DPF sequence motif. One member is putatively named as receptor for egg jelly protein but this could not confirmed.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry C6_DPF