The domain within your query sequence starts at position 113 and ends at position 175; the E-value for the CAAP1 domain shown below is 3.2e-31.
LKPVSFYISDKKEMLQQCFCIIGEKKLQKMLPDVLKNCSVEEIKKLCQEQLELLSEKQIL KIL
CAAP1 |
---|
PFAM accession number: | PF15335 |
---|---|
Interpro abstract (IPR038991): | CAAP1, or caspase activity and apoptosis inhibitor 1, is a family of eukaryotic proteins involved in the regulation of apoptosis. It modulates a caspase-10 dependent mitochondrial caspase-3/9 feedback amplification loop [ (PUBMED:21980415) ]. |
GO process: | regulation of apoptotic process (GO:0042981) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAAP1