The domain within your query sequence starts at position 859 and ends at position 917; the E-value for the CAMSAP_CC1 domain shown below is 3.8e-29.
PGRHSKDPASLLASELVQLHMQLEEKRRAIEAQKKKMEALSARQRLKLGKAAFLHVVKK
CAMSAP_CC1 |
---|
PFAM accession number: | PF17095 |
---|---|
Interpro abstract (IPR031372): | This entry represents a conserved region found in calmodulin regulated spectrin-associated proteins (CAMSAPs) from animals. CAMSAPs are a group of microtubule-binding proteins. This conserved region (also known as CC1 region) binds to both spectrin and Ca2+/calmodulin in vitro, although the binding of Ca2+/calmodulin inhibited the binding of spectrin. CC1 appears to be a functional region of CAMSAP1 that links spectrin-binding to neurite outgrowth [ (PUBMED:24117850) ]. |
GO process: | neuron projection development (GO:0031175) |
GO function: | spectrin binding (GO:0030507), calmodulin binding (GO:0005516) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAMSAP_CC1