The domain within your query sequence starts at position 228 and ends at position 311; the E-value for the CAMSAP_CH domain shown below is 3.3e-35.
HLSARQSPYFPLLEDLMRDGSDGAALLAVVHYYCPEQMKLDDICLKEVPSMADSLYNIRL LREFSNEHLNKCFYLTLEDMLYAP
CAMSAP_CH |
 |
|---|
| PFAM accession number: | PF11971 |
|---|---|
| Interpro abstract (IPR022613): | This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAMSAP_CH