SMART: Pfam domain CAS

The domain within your query sequence starts at position 225 and ends at position 649; the E-value for the CAS_CSE1 domain shown below is 2.3e-195.

HLEAETAEIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQ
LTQKLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFLVFTEILQNDVQ
EFIPYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGNIPALVRLLQAFLERGSS
TIATAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQIFILLFQR
LQNSKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNV
EKKICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDSIPDEEHFIDIEDTP
GYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQ
YLQGY

CAS_CSE1

PFAM accession number:	PF03378
Interpro abstract (IPR005043):	This entry represents the C-terminal domain of XPO2. Structural studies of its yeast homologue, Cse1, indicate that this domain binds to both the transport-orchestrating protein RanGTP and the cargo molecule that is being exported [ (PUBMED:15602554) ]. Exportin-2, also known as CAS, is an export receptor for importin-alpha [ (PUBMED:9323134) ]. It binds strongly to importin alpha only in the presence of RanGTP, forming an importin alpha/CAS/RanGTP complex. Exportin-2 mediates importin-alpha re-export from the nucleus to the cytoplasm after import substrates have been released into the nucleoplasm [ (PUBMED:10394916) ].
GO function:	Ran GTPase binding (GO:0008536), protein binding (GO:0005515)

PFAM accession number:

PF03378

Interpro abstract (IPR005043):

This entry represents the C-terminal domain of XPO2. Structural studies of its yeast homologue, Cse1, indicate that this domain binds to both the transport-orchestrating protein RanGTP and the cargo molecule that is being exported [ (PUBMED:15602554) ].

Exportin-2, also known as CAS, is an export receptor for importin-alpha [ (PUBMED:9323134) ]. It binds strongly to importin alpha only in the presence of RanGTP, forming an importin alpha/CAS/RanGTP complex. Exportin-2 mediates importin-alpha re-export from the nucleus to the cytoplasm after import substrates have been released into the nucleoplasm [ (PUBMED:10394916) ].

GO function:

Ran GTPase binding (GO:0008536), protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAS_CSE1