The domain within your query sequence starts at position 1 and ends at position 93; the E-value for the CATSPERG domain shown below is 1.7e-52.

TVAKVFQKLTDSPIDPSENYLSFPYYLQINFSCPGQNSEELARKGHLMGMKPMVRINYMY
SVNFYRWEMENLQILMEAAPMRSTEPCSEVESL

CATSPERG

CATSPERG
PFAM accession number:PF15064
Interpro abstract (IPR028246):

This family represents the gamma subunit of the CATSPER, or cation channel sperm-associated protein complex [ (PUBMED:19516020) ]. The complex appears only to be expressed in the flagellum of sperm, and it is activated at alkaline intracellular pH [ (PUBMED:21224844) ].

GO component:sperm principal piece (GO:0097228), CatSper complex (GO:0036128)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CATSPERG