The domain within your query sequence starts at position 75 and ends at position 161; the E-value for the CBM_48 domain shown below is 1.8e-17.
SFGIHRCSDGGIYCKEWAPGAEGVFLTGEFSGWNPFSHPYKKLEYGKWELYIPPKQNKSP LIPHGSKLKVVITSKSGEILYRISPWA
CBM_48 |
 |
|---|
| PFAM accession number: | PF02922 |
|---|---|
| Interpro abstract (IPR004193): | O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website. Enzymes containing this domain belong to family 13 of the glycosyl hydrolases. This domain is found in a range of enzymes that act on branched substrates ie. isoamylase, pullulanase and branching enzyme. Isoamylase hydrolyses 1,6-alpha-D-glucosidic branch linkages in glycogen, amylopectin and dextrin; 1,4-alpha-glucan branching enzyme functions in the formation of 1,6-glucosidic linkages of glycogen; and pullulanase is a starch-debranching enzyme. |
| GO process: | carbohydrate metabolic process (GO:0005975) |
| GO function: | hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBM_48