The domain within your query sequence starts at position 117 and ends at position 337; the E-value for the CCDC106 domain shown below is 1.4e-100.
LALMSSVKAQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMDAEDYCRMKPGP RRVDGDSRAGVGEASDPESAASSFSGVSEDGSASERKRQKQKGSTSRKRFGKTKARERQR VKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGE FDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITY
CCDC106 |
---|
PFAM accession number: | PF15794 |
---|---|
Interpro abstract (IPR031591): | CCDC106, coiled-coil domain-containing protein 106, is a family of eukaryote proteins. Yeast two-hybrid screening has identified CCDC106 as a p53-interacting partner [ (PUBMED:16169070) ]. CCDC106 is a negative regulator of p53 and may be involved in tumourigenesis in some cancers by promoting the degradation of p53 protein and inhibiting its transactivity [ (PUBMED:20159018) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC106