The domain within your query sequence starts at position 139 and ends at position 277; the E-value for the CCDC117 domain shown below is 1.9e-56.
QCEVARRRLQEIEDRIIDEDEEVESDRNVSHLPSLVLSDTMKTGLKREFDEVFTKRMIES MSRPSMELVLWKPLPELLPEKPKPSSSPKNYRRESQAKHAAPGTAFPQRTEGLLEPQCAD APLYRSLEAATSTEEEMEL
CCDC117 |
---|
PFAM accession number: | PF15810 |
---|---|
Interpro abstract (IPR031630): | CCDC117 is a family of coiled-coil proteins found in eukaryotes. Proteins in this family are typically between 203 and 279 amino acids in length. There is a conserved MELV sequence motif. The function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC117