The domain within your query sequence starts at position 2 and ends at position 202; the E-value for the CCDC168_N domain shown below is 2.5e-83.
SYIEEDGVNIFERISMHPTAKHVNRKKSPLSCAPKIKRFKVDLEEQSKKKHESSRGKVML LRETCSVITSSDVFKLDISEEVETETMQSHVPYPVLQKPLPVGQVGSTKTIDNNFTKRKL HPPWEEEVQTSAIENLTYLRGPIFMTKISAPPCVSSVKKHRTLSQKTHQWNSNEKTGQKQ ERTRHRNVVATKRDASIPLLT
CCDC168_N |
---|
PFAM accession number: | PF15804 |
---|---|
Interpro abstract (IPR031624): | This domain corresponds to the N-terminal region of eukaryotic coiled-coil proteins 168. There are up to 17, on average 6, copies of this domain in most members. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC168_N