The domain within your query sequence starts at position 200 and ends at position 302; the E-value for the CCDC168_N domain shown below is 1.7e-26.
LLTTGQIASTKQISECSKRKILLPVQEEVQTPTTDGSTYSSDIVLKAKISAPIHVFSLSE HSTPRKRKTPHGKIKKKIRQKQEKARKFNMYVMKTDSSIPSRA
CCDC168_N |
 |
|---|
| PFAM accession number: | PF15804 |
|---|---|
| Interpro abstract (IPR031624): | This domain corresponds to the N-terminal region of eukaryotic coiled-coil proteins 168. There are up to 17, on average 6, copies of this domain in most members. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC168_N