The domain within your query sequence starts at position 47 and ends at position 117; the E-value for the CD20 domain shown below is 8e-20.

VMAAIQIMCAVMVLSLGIILASVPSNLHFTSVFSVLLKSGYPFIGALFFIVSGILSIVTE
TKSTKILLLMK

CD20

CD20
PFAM accession number:PF04103
Interpro abstract (IPR007237):

This entry includes B-lymphocyte antigen CD20 and other members of the membrane-spanning 4-domains subfamily A (MS4A), and closely related TMEM176 proteins [ (PUBMED:20186339) (PUBMED:23874341) ]. It also includes sarcospan and some uncharacterised proteins.

The MS4A family includes the B-cell-specific antigen CD20, hematopoietic-cell-specific protein HTm4, high affinity IgE receptor beta chain (FceRIbeta), and related proteins [ (PUBMED:11245982) ]. Members of this family have four putative transmembrane segments and are predominantly expressed in hematopoietic cells, with important roles in immunity [ (PUBMED:11401424) ].

Sarcospan is a transmembrane component of dystrophin-glycoprotein complex (DGC), a complex that spans the muscle plasma membrane and forms a link between the F-actin cytoskeleton and the extracellular matrix. Sarcospan preferentially associates with the sarcoglycan subcomplex of the DGC. Loss of the sarcoglycan complex and sarcospan alone is sufficient to cause muscular dystrophy. The role of the sarcoglycan complex and sarcospan is thought to be to strengthen the dystrophin axis connecting the basement membrane with the cytoskeleton [ (PUBMED:10441321) ].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD20