The domain within your query sequence starts at position 24 and ends at position 101; the E-value for the CD225 domain shown below is 2.9e-31.
TINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSVKSRDRKMVGDTTGAQAFASTAKC LNISSLFFTILTAIVVIV
CD225 |
![]() |
---|
PFAM accession number: | PF04505 |
---|---|
Interpro abstract (IPR007593): | This family represents a set of transmembrane proteins including various interferon-induced transmembrane proteins, synapse differentiation-inducing gene protein 1, and tumor suppressor candidate 5 and homologues. Interferon-induced transmembrane protein 1 (also known as human leukocyte antigen CD225) is associated with interferon induced cell growth suppression [ (PUBMED:7559564) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD225