The domain within your query sequence starts at position 24 and ends at position 101; the E-value for the CD225 domain shown below is 2.9e-31.

TINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSVKSRDRKMVGDTTGAQAFASTAKC
LNISSLFFTILTAIVVIV

CD225

CD225
PFAM accession number:PF04505
Interpro abstract (IPR007593):

This family represents a set of transmembrane proteins including various interferon-induced transmembrane proteins, synapse differentiation-inducing gene protein 1, and tumor suppressor candidate 5 and homologues. Interferon-induced transmembrane protein 1 (also known as human leukocyte antigen CD225) is associated with interferon induced cell growth suppression [ (PUBMED:7559564) ].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD225