SMART: Pfam domain CD34

The domain within your query sequence starts at position 301 and ends at position 503; the E-value for the CD34_antigen domain shown below is 6e-76.

ILNLTRASLCERSPLDEKEKLVELLCHSVKASFKPAEDLCTLHVAPILDNQAVAVKRIII
ETKLSPKAVYELLKDRWDDLTEAGVSDMKLGKEGPPEVNEDRFSLPLIITIVCMASFLLL
VAALYGCCHQRISQRKDQQRLTEELQTVENGYHDNPTLEVMETPSEMQEKKVVNLNGELG
DSWIVPLDNLTKDDLDEEEDTHL

CD34_antigen

PFAM accession number:	PF06365
Interpro abstract (IPR013836):	This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [ (PUBMED:10722749) (PUBMED:1694174) ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [ (PUBMED:10982412) ].

PFAM accession number:

PF06365

Interpro abstract (IPR013836):

This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [ (PUBMED:10722749) (PUBMED:1694174) ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [ (PUBMED:10982412) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD34_antigen