The domain within your query sequence starts at position 163 and ends at position 317; the E-value for the CD47 domain shown below is 4.7e-62.
LIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLVLTVIVVVGAILLIPGEKP VKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLALVGLCLCIMAC EPVHGPLLISGLGIIALAELLGLVYMKFVASNQRT
CD47 |
![]() |
---|
PFAM accession number: | PF04549 |
---|---|
Interpro abstract (IPR013147): | This family represents the transmembrane region of CD47 leukocyte antigen [ (PUBMED:8794870) (PUBMED:12124426) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD47