The domain within your query sequence starts at position 18 and ends at position 168; the E-value for the CD99L2 domain shown below is 3.8e-52.
TLVQRGYGDTDGFNLEDALKETSSVKQLDGFDLEDALDDRNDLDGPKKPSAGEAGGWSDK DLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETGTIAGVASALAMALIGAVSSYISY QQKKFCFSIQQGLNADYVKGENLEAVVCEEP
CD99L2 |
---|
PFAM accession number: | PF12301 |
---|---|
Interpro abstract (IPR022078): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 165 and 237 amino acids in length. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD99L2