The domain within your query sequence starts at position 54 and ends at position 339; the E-value for the CDC50 domain shown below is 2.7e-84.
LLSAKSTKKIEINYTKTCANCAQLRENSSNFDKACNCSLPFYLPEKMEGDVYMYYKLYGF YQNLYQYILSRSNSQLVGKDIWDTTNCDPFQVSHNDTPIIPCGAIANSIFNDTITLSYNL NSSTQIEVPMLKSGLTWWTDKYVKFRNPRSSNFTSTFAGSSKPLHWAKPIYELDLDDPGN NGFLNEDFIVWMRTAAFPTFKKLYRRLKRVHAFAEGLPAGNYSLSISYNFPVTMFQGEKS IVLSTLTWIGGGGLFLGLTYTVTGALTLLASFAILTIHLMLKRSKL
CDC50 |
![]() |
---|
PFAM accession number: | PF03381 |
---|---|
Interpro abstract (IPR005045): | CDC50/LEM3 is a family of membrane proteins whose members include cell cycle control protein 50, alkylphosphocholine resistance protein LEM3, which is is required for phospholipid translocation across the plasma membrane in Saccharomyces cerevisiae [ (PUBMED:12133835) ], and several ALA-interacting subunits, which are plant proteins involved in lipid translocation and secretory vesicle formation [ (PUBMED:18344284) ]. |
GO component: | membrane (GO:0016020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDC50