The domain within your query sequence starts at position 19 and ends at position 67; the E-value for the CDI domain shown below is 8.1e-23.
CLFGPVDSEQLRRDCDALMAGCLQEARERWNFDFVTETPLEGNFVWERV
CDI |
---|
PFAM accession number: | PF02234 |
---|---|
Interpro abstract (IPR003175): | Cell cycle progression is negatively controlled by cyclin-dependent kinases inhibitors (CDIs). CDIs are involved in cell cycle arrest at the G1 phase. |
GO process: | cell cycle arrest (GO:0007050) |
GO component: | nucleus (GO:0005634) |
GO function: | cyclin-dependent protein serine/threonine kinase inhibitor activity (GO:0004861) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDI