The domain within your query sequence starts at position 30 and ends at position 80; the E-value for the CDI domain shown below is 8.5e-26.
RNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVE
CDI |
 |
|---|
| PFAM accession number: | PF02234 |
|---|---|
| Interpro abstract (IPR003175): | Cell cycle progression is negatively controlled by cyclin-dependent kinases inhibitors (CDIs). CDIs are involved in cell cycle arrest at the G1 phase. |
| GO process: | cell cycle arrest (GO:0007050) |
| GO component: | nucleus (GO:0005634) |
| GO function: | cyclin-dependent protein serine/threonine kinase inhibitor activity (GO:0004861) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDI