The domain within your query sequence starts at position 81 and ends at position 229; the E-value for the CDP-OH_P_transf domain shown below is 6.4e-23.
SWIAPNLITIIGLSINICTTILLVFYCPTATEQAPLWAYIACACGLFIYQSLDAIDGKQA RRTNSSSPLGELFDHGCDSLSTVFVVLGTCIAVQLGTNPDWMFFCCFAGTFMFYCAHWQT YVSGTLRFGIFDVTESQILIILFQLLSGT
CDP-OH_P_transf |
---|
PFAM accession number: | PF01066 |
---|---|
Interpro abstract (IPR000462): | A number of phosphatidyltransferases, which are all involved in phospholipid biosynthesis and that share the property of catalysing the displacement of CMP from a CDP-alcohol by a second alcohol with formation of a phosphodiester bond and concomitant breaking of a phosphoride anhydride bond share a conserved sequence region [ (PUBMED:3031032) (PUBMED:1848238) ]. These enzymes are proteins of 200 to 400 amino acid residues. The conserved region contains three aspartic acid residues and is located in the N-terminal section of the sequences. |
GO process: | phospholipid biosynthetic process (GO:0008654) |
GO component: | membrane (GO:0016020) |
GO function: | phosphotransferase activity, for other substituted phosphate groups (GO:0016780) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDP-OH_P_transf