The domain within your query sequence starts at position 31 and ends at position 165; the E-value for the CDRT4 domain shown below is 3.6e-73.

RLTENIGLPLILLEKHNPWPAYVAYISPAVTRITEKGWARDLEYIYAAEKNGKPVKRSKH
SAVLLKRRKPSKPSELMLKETLSETMLPTWECSTIYVSPTFVPEPAQLQMDVREGPTSNY
NKIIFSKRPAMRKLP

CDRT4

• PFAM accession number: PF15213
• Interpro abstract (IPR029185):

  Charcot-Marie-Tooth disease type 1A (CMT1A) is the most common inherited peripheral neuropathy and one of the best-characterised examples of a submicroscopic genomic disorder. In most cases it is due to a submicroscopic duplication of the 1.4-Mb genomic region in chromosome band 17p12. This putative protein represents the product of transcript 4 in this region [ (PUBMED:11381029) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDRT4