The domain within your query sequence starts at position 2850 and ends at position 2896; the E-value for the CENP-F_C_Rb_bdg domain shown below is 6.6e-29.
PAEHEQETEFEPEGLPEVVKKGFADIPTGKTSPYILRRTTMATRTSP
CENP-F_C_Rb_bdg |
![]() |
---|
PFAM accession number: | PF10490 |
---|---|
Interpro abstract (IPR018302): | This entry represents the Rb protein-binding domain from the centromere protein Cenp-F. Cenp-F is a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, that is involved in chromosome segregation during mitosis and is essential for the full functioning of the mitotic checkpoint pathway [ (PUBMED:7542657) (PUBMED:14555653) ]. Cenp-F interacts with retinoblastoma protein (RB), CENP-E and BUBR1. This domain is at the very C terminus of the C-terminal coiled-coil region, and binds to the Rb family of tumour suppressors [ (PUBMED:17498689) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-F_C_Rb_bdg