The domain within your query sequence starts at position 1 and ends at position 65; the E-value for the CENP-F_N domain shown below is 8.7e-35.

MSWALEEWKEGLPSRALQKIQELEGQLEKLKKEKQQRQFQLDSLEAALQKQKQKVSVWQA
ADCWL

CENP-F_N

CENP-F_N
PFAM accession number:PF10481
Interpro abstract (IPR018463):

Mitosin or centromere-associated protein-F (Cenp-F) is a coiled-coil protein that dimerizes and localizes to diverse subcellular locations, including microtubule plus-ends, mitochondria, nuclear pores, and kinetochores [ (PUBMED:32207772) ]. It localizes to kinetochores during mitosis and is then rapidly degraded after mitosis. It is required for kinetochore-microtubule interactions and spindle checkpoint function [ (PUBMED:17600710) ]. Cenp-F contains two microtubule-binding domains, and physically associates with dynein motor regulators [ (PUBMED:26101217) ]. Cenp-F has also been shown to couple mitochondria to dynamic microtubule tips [ (PUBMED:28701340) ].

This entry represents the N-terminal region of Cenp-F.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-F_N