SMART: Pfam domain CENP-M

The domain within your query sequence starts at position 1 and ends at position 172; the E-value for the CENP-M domain shown below is 1.1e-83.

MSVLRSMDKLPDLNRATVLLVSTEDALLQQLAESMLKDDCASELRVHLANSLPLPSNVNR
PRIDLIVFVINLHSKYSLQKVEEFLQHVDSSFFLGKVCFLVTGAGQESHCSVHQNTVIKL
AHTYRSPLLLCDLQVESFRAAMARRLVRILQICAGHVPGVSALNLMSLLRSP

CENP-M

PFAM accession number:	PF11111
Interpro abstract (IPR020987):	The prime candidate for specifying centromere identity is the array of nucleosomes assembles associated with CENP-A [ (PUBMED:16622419) ]. CENP-A recruits a nucleosome associated complex (CENP-A-NAC complex) comprised of CENP-M which this entry represents, along with two other proteins [ (PUBMED:16622419) ]. Assembly of the CENP-A NAC at centromeres is partly dependent on CENP-M. The CENP-A NAC is essential, as disruption of the complex causes errors of chromosome alignment and segregation that preclude cell survival [ (PUBMED:16622419) ].

PFAM accession number:

PF11111

Interpro abstract (IPR020987):

The prime candidate for specifying centromere identity is the array of nucleosomes assembles associated with CENP-A [ (PUBMED:16622419) ]. CENP-A recruits a nucleosome associated complex (CENP-A-NAC complex) comprised of CENP-M which this entry represents, along with two other proteins [ (PUBMED:16622419) ]. Assembly of the CENP-A NAC at centromeres is partly dependent on CENP-M. The CENP-A NAC is essential, as disruption of the complex causes errors of chromosome alignment and segregation that preclude cell survival [ (PUBMED:16622419) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-M