The domain within your query sequence starts at position 25 and ends at position 162; the E-value for the CENP-R domain shown below is 1e-63.

RKKSITAYSPTTGTYQLSPFSSPATPKEQEHRNGPSNETRKRSNLSSPVRQESTVKDRDG
FMVLLSKIEISSEKTMEIMKNLSSIQALEGNRQLEDLIGVSLVPCSLKSEARKTKELMTK
VIKQKLFEKKKSRITPKD

CENP-R

 CENP-R
PFAM accession number:PF06729
Interpro abstract (IPR009601):

Centromere protein R (CENP-R, also known as NRIF3) is a transcription co-regulator that can have both co-activator and co-repressor functions [ (PUBMED:10490654) (PUBMED:11713274) ]. It is involved in the co-activation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion [ (PUBMED:12244126) (PUBMED:15254226) ]. It is a probable component of a centromeric complex involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation [ (PUBMED:16622419) ].

GO process:regulation of transcription, DNA-templated (GO:0006355), CENP-A containing nucleosome assembly (GO:0034080)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-R