SMART: Pfam domain CENP-S

The domain within your query sequence starts at position 16 and ends at position 75; the E-value for the CENP-S domain shown below is 3.4e-23.

QRLKAAVHYTVGCLCQEVTLNKQVNFSKQTIAAISEVTFRQCENFAKDLEMFARWVEKLA

CENP-S

PFAM accession number:	PF15630
Interpro abstract (IPR029003):	This entry includes animal centromere protein S (CENP-S) and its yeast homologue, Mhf1. CENP-S/Mhf1 is a component of the FANCM-MHF complex, an essential DNA-remodeling complex that protects replication forks in response to DNA damage [ (PUBMED:20347428) (PUBMED:24026537) (PUBMED:24256282) ]. FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork [ (PUBMED:20347428) (PUBMED:24026537) ]. CENP-S is a dual function protein. It aids DNA repair/recombination and localises to centromeres to promote chromosome segregation [ (PUBMED:24256282) ]. It is a kinetochore component that forms complexes with CENP-X to form a stable CENP-T-W-S-X heterotetramer [ (PUBMED:20702077) (PUBMED:22304917) ].
GO component:	FANCM-MHF complex (GO:0071821)

PFAM accession number:

PF15630

Interpro abstract (IPR029003):

This entry includes animal centromere protein S (CENP-S) and its yeast homologue, Mhf1. CENP-S/Mhf1 is a component of the FANCM-MHF complex, an essential DNA-remodeling complex that protects replication forks in response to DNA damage [ (PUBMED:20347428) (PUBMED:24026537) (PUBMED:24256282) ]. FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork [ (PUBMED:20347428) (PUBMED:24026537) ].

CENP-S is a dual function protein. It aids DNA repair/recombination and localises to centromeres to promote chromosome segregation [ (PUBMED:24256282) ]. It is a kinetochore component that forms complexes with CENP-X to form a stable CENP-T-W-S-X heterotetramer [ (PUBMED:20702077) (PUBMED:22304917) ].

GO component:

FANCM-MHF complex (GO:0071821)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-S