SMART: Pfam domain CENP-X

The domain within your query sequence starts at position 44 and ends at position 114; the E-value for the CENP-X domain shown below is 6.1e-24.

HLELVSRLLHLHFRDCKTKVSGDALQLMAEFLRIFVLEAAVRGVWQAQAEDLDVVEVDQL
EKVLPQLLLDF

CENP-X

PFAM accession number:	PF09415
Interpro abstract (IPR018552):	Centromere protein X (CENP-X) is a component of several different complexes, including the multisubunit FA complex, the heterotetrameric CENP-T-W-S-X complex and the APITD1/CENPS complex. The Fanconi anemia (FA) core complex is involved in DNA damage repair and genome maintenance. The FA complex is composed of CENPS, FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL/PHF9, FANCM, FAAP24 and CENPX. Interacts with CENPS, FANCM and FAAP24 [ (PUBMED:20347428) (PUBMED:20347429) ]. Inner kinetochore subunit mhf2 is the dsDNA-binding component of the FANCM-MHF complex, important for gene conversion at blocked replication forks [ (PUBMED:20347428) ] and non-crossover recombination during mitosis and meiosis [ (PUBMED:22723423) ]. The CENP-T-W-S-X complex binds, supercoils DNA and plays an important role in kinetochore assembly [ (PUBMED:22304917) ]. The APITD1/CENPS complex is composed of at least of CENP-S and CENP-X and is essential for the stable assembly of the outer kinetchore [ (PUBMED:19620631) ].
GO process:	DNA repair (GO:0006281), kinetochore assembly (GO:0051382)

PFAM accession number:

PF09415

Interpro abstract (IPR018552):

Centromere protein X (CENP-X) is a component of several different complexes, including the multisubunit FA complex, the heterotetrameric CENP-T-W-S-X complex and the APITD1/CENPS complex.

The Fanconi anemia (FA) core complex is involved in DNA damage repair and genome maintenance. The FA complex is composed of CENPS, FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL/PHF9, FANCM, FAAP24 and CENPX. Interacts with CENPS, FANCM and FAAP24 [ (PUBMED:20347428) (PUBMED:20347429) ]. Inner kinetochore subunit mhf2 is the dsDNA-binding component of the FANCM-MHF complex, important for gene conversion at blocked replication forks [ (PUBMED:20347428) ] and non-crossover recombination during mitosis and meiosis [ (PUBMED:22723423) ].

The CENP-T-W-S-X complex binds, supercoils DNA and plays an important role in kinetochore assembly [ (PUBMED:22304917) ].

The APITD1/CENPS complex is composed of at least of CENP-S and CENP-X and is essential for the stable assembly of the outer kinetchore [ (PUBMED:19620631) ].

GO process:

DNA repair (GO:0006281), kinetochore assembly (GO:0051382)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-X