The domain within your query sequence starts at position 6 and ends at position 156; the E-value for the CEP19 domain shown below is 4.8e-56.
KKCGVRFQPPAVILIYENETEGKSRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQV PLKQLEKLFVFLRGSLQGQSLAETMEQIRRETTIDPEEDLNKLDDKELAKRKSIMDELFE KNQKRKDDPTFVYDVEVEFPQDEQLLSCSWD
CEP19 |
---|
PFAM accession number: | PF14933 |
---|---|
Interpro abstract (IPR029412): | This entry represents the centrosomal protein of 19kDa (CEP19, also known as C3orf34) from eukaryotes. It was identified by complementary proteomics methods [ (PUBMED:21399614) ]. It associates with the mother centriole in early interphase. It localises to spindle poles during mitosis, and to distinct foci oriented towards the midbody at telophase [ (PUBMED:21399614) ]. Its function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEP19