The domain within your query sequence starts at position 5 and ends at position 80; the E-value for the CEP44 domain shown below is 1e-28.
DLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIE LIAKNDVRFTDTVYKL
CEP44 |
---|
PFAM accession number: | PF15007 |
---|---|
Interpro abstract (IPR029157): | Several proteins have been identified that localise to centrosomes and spindle poles, and they have been named accordingly to their molecular weight [ (PUBMED:21399614) ]. This entry represents a coiled coil domain found in centrosomal protein of 44kDa (CEP44). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEP44