SMART: Pfam domain CFTR

The domain within your query sequence starts at position 639 and ends at position 844; the E-value for the CFTR_R domain shown below is 2e-93.

DFSSKLMGYDTFDQFTEERRSSILTETLRRFSVDDSSAPWSKPKQSFRQTGEVGEKRKNS
ILNSFSSVRKISIVQKTPLCIDGESDDLQEKRLSLVPDSEQGEAALPRSNMIATGPTFPG
RRRQSVLDLMTFTPNSGSSNLQRTRTSIRKISLVPQISLNEVDVYSRRLSQDSTLNITEE
INEEDLKECFLDDVIKIPPVTTWNTY

CFTR_R

PFAM accession number:	PF14396
Interpro abstract (IPR025837):	Cystic fibrosis transmembrane conductance regulator (CFTR) that belongs to the ATP-binding cassette (ABC) transporter superfamily. It is a member of the ABC-C subfamily, which also contains the SUR receptors and the multidrug- resistance associated proteins (MRP) [ (PUBMED:11435397) ]. The CFTR protein encodes a chloride ion channel, which is controlled by phosphorylation. It has a major role in electrolyte and fluid secretion. CFTR is important in the determination of fluid flow, ion concentration and transepithelial salt transport. Dysfunction of the CFTR channel causes the life-threatening disease, cystic fibrosis, in which trans-epithelial ion transport is disrupted [ (PUBMED:9922375) ]. This entry represents the CFTR regulator domain [ (PUBMED:16001079) (PUBMED:17660831) (PUBMED:21059651) ].

PFAM accession number:

PF14396

Interpro abstract (IPR025837):

Cystic fibrosis transmembrane conductance regulator (CFTR) that belongs to the ATP-binding cassette (ABC) transporter superfamily. It is a member of the ABC-C subfamily, which also contains the SUR receptors and the multidrug- resistance associated proteins (MRP) [ (PUBMED:11435397) ]. The CFTR protein encodes a chloride ion channel, which is controlled by phosphorylation. It has a major role in electrolyte and fluid secretion. CFTR is important in the determination of fluid flow, ion concentration and transepithelial salt transport. Dysfunction of the CFTR channel causes the life-threatening disease, cystic fibrosis, in which trans-epithelial ion transport is disrupted [ (PUBMED:9922375) ].

This entry represents the CFTR regulator domain [ (PUBMED:16001079) (PUBMED:17660831) (PUBMED:21059651) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CFTR_R