The domain within your query sequence starts at position 20 and ends at position 172; the E-value for the CGI-121 domain shown below is 1.3e-47.
FKDVKNAGDLRKKAMEGSIDGSLINPNVIVDPFQILVAANKAVHLHRLGKMKTRTLSTEI IFNLSPNNNISEALKKFGISETNTSVLIVYIEDGSKQVPQEHLVSQVEGQQVPLESLPEI TRLSEVKKIYKLSSQEERIGTLLDAIICRMSTK
CGI-121 |
---|
PFAM accession number: | PF08617 |
---|---|
Interpro abstract (IPR013926): | This entry represents the EKC/KEOPS complex subunit Cgi121 from fungi and its homologue, TPRKB from mammals. This entry also includes archaeal homologues [ (PUBMED:18951093) ]. CGI121 is part of the KEOPS complex, which is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine [ (PUBMED:21183954) ]. The KEOPS complex also plays an important part in telomere uncapping and telomere elongation and is required for efficient recruitment of transcriptional coactivators [ (PUBMED:16564010) ]. TPRKB has been shown to bind to the p53-related protein kinase (PRPK) [ (PUBMED:12659830) ]. PRPK is a novel protein kinase which binds to and induces phosphorylation of the tumour suppressor protein p53. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CGI-121