SMART: Pfam domain CHDCT2

The domain within your query sequence starts at position 1727 and ends at position 1899; the E-value for the CHDCT2 domain shown below is 1.9e-98.

KTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLA
RRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGN
KPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRL

CHDCT2

PFAM accession number:	PF08074
Interpro abstract (IPR012957):	This entry represents the C-terminal domain of CHD (Chromodomain, Helicase, DNA-binding) proteins. CHD3 and CHD4 belong to the class II subfamily of CHD ATPases, and each is present as a core catalytic subunit in separate NuRD complexes, which regulate chromatin organisation and gene transcription [ (PUBMED:23340908) ]. CHD5 forms a NuRD-type chromatin remodeling complex and acts as a tumour suppressor [ (PUBMED:24419087) ]. There are nine members of the Chromodomain, Helicase, DNA-binding (CHD) family. They are characterised by two chromodomains arranged in tandem, N-terminal to the ATPase/helicase domain. Chromodomains are comprised of a beta-sheet folded against an alpha-helix that collectively mediates binding to methyl-lysine residues [ (PUBMED:23954449) ].

PFAM accession number:

PF08074

Interpro abstract (IPR012957):

This entry represents the C-terminal domain of CHD (Chromodomain, Helicase, DNA-binding) proteins. CHD3 and CHD4 belong to the class II subfamily of CHD ATPases, and each is present as a core catalytic subunit in separate NuRD complexes, which regulate chromatin organisation and gene transcription [ (PUBMED:23340908) ]. CHD5 forms a NuRD-type chromatin remodeling complex and acts as a tumour suppressor [ (PUBMED:24419087) ].

There are nine members of the Chromodomain, Helicase, DNA-binding (CHD) family. They are characterised by two chromodomains arranged in tandem, N-terminal to the ATPase/helicase domain. Chromodomains are comprised of a beta-sheet folded against an alpha-helix that collectively mediates binding to methyl-lysine residues [ (PUBMED:23954449) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CHDCT2