The domain within your query sequence starts at position 125 and ends at position 158; the E-value for the CIAPIN1 domain shown below is 1.8e-9.
KSSSVKPVVDPAAAKLWTLSANDMEDDSVDLIDS
CIAPIN1 |
---|
PFAM accession number: | PF05093 |
---|---|
Interpro abstract (IPR007785): | Anamorsin (also named CIAPIN1 for cytokine-induced anti-apoptosis inhibitor 1), is the human homologue of yeast Dre2, a conserved soluble eukaryotic Fe-S cluster protein, that functions in cytosolic Fe-S protein biogenesis [ (PUBMED:20802492) (PUBMED:21700214) ]. It is found in both the cytoplasm and in the mitochondrial intermembrane space (IMS) [ (PUBMED:18625724) ]. Anamorsin is found to be up-regulated in hepatocellular cancer, is considered to be a downstream effector of the receptor tyrosine kinase-Ras signalling pathway, and is essential in mouse definitive haematopoiesis [ (PUBMED:18299278) ]. In addition, it mediates the anti-apoptotic effects of various cytokines [ (PUBMED:14970183) ]. |
GO process: | iron-sulfur cluster assembly (GO:0016226) |
GO component: | cytoplasm (GO:0005737) |
GO function: | iron-sulfur cluster binding (GO:0051536) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CIAPIN1