The domain within your query sequence starts at position 51 and ends at position 80; the E-value for the CLLAC domain shown below is 2.5e-16.

RCSLWKVFLICLLACLVATSITALAFYFGP

CLLAC

• PFAM accession number: PF15675
• Interpro abstract (IPR031379):

  This short domain is found in chordates. It carries a highly conserved CLLAC sequence motif. The function is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLLAC