The domain within your query sequence starts at position 27 and ends at position 306; the E-value for the CLN6 domain shown below is 1.3e-167.
GSVKAEDKDRTAPFHLDLWFYFTLQNWVLDFGRPIAMLVFPIQWFPLNKPSVGDYFHMTY NIITPFLLLKLIERSPRTLPRSIVYVSIITFIMGASIHLVGDSVNHRLLFSGYQHHLSVR ENPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILFMYFSGCFTTCKAESHMPGP ALLLVVPSGLYYWYLVTEGQIFILFIFTFFAMLALVLHQKRRRLFLDSNGLFLLYSFALT LSLVALWVAWLWNDPVLRKKYPGVIYVPEPWAFYTLHVSS
CLN6 |
---|
PFAM accession number: | PF15156 |
---|---|
Interpro abstract (IPR029255): | Mutations in CLN6 (ceroid-lipofuscinosis neuronal protein 6) cause variant late-onset neuronal ceroid lipofuscinosis (vLINCL), a childhood neurodegenerative disorder (CLN6). Alterations in neurite maturation resulting from a loss of CLN6 interaction with protein CRMP2, which has been implicated in controlling axon number and outgrowth, may contribute to this neuronal pathology [ (PUBMED:19235893) ]. A link between CLN6 expression and biometal homeostasis has been suggested [ (PUBMED:23789114) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLN6