SMART: Pfam domain CLZ

The domain within your query sequence starts at position 10 and ends at position 75; the E-value for the CLZ domain shown below is 1.2e-9.

QMLKLDKENVLDRAEQAEAEQKQAEERSKQLEDELATMQKKLKGTEDELDKYSEALKDAQ
EKLELA

CLZ

PFAM accession number:	PF16526
Interpro abstract (IPR032406):	This entry represents the C-terminal leucine-zipper domain (also known as CLZ domain) of of cyclic nucleotide-gated channel proteins. This domain forms homotypic trimers in solution thus constraining the channel of the CNGs to contain three cyclic nucleotide-gated subunits, CNGA. The CLZ domains formed homotypic parallel 3-helix coiled-coil domains, consistent with their proposed role in regulating subunit assembly [ (PUBMED:21878911) ].

PFAM accession number:

PF16526

Interpro abstract (IPR032406):

This entry represents the C-terminal leucine-zipper domain (also known as CLZ domain) of of cyclic nucleotide-gated channel proteins. This domain forms homotypic trimers in solution thus constraining the channel of the CNGs to contain three cyclic nucleotide-gated subunits, CNGA. The CLZ domains formed homotypic parallel 3-helix coiled-coil domains, consistent with their proposed role in regulating subunit assembly [ (PUBMED:21878911) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLZ