The domain within your query sequence starts at position 308 and ends at position 598; the E-value for the CNDH2_C domain shown below is 1.9e-90.
PWQSLDPFDSLESKVFQKGKPYSVPPGVEEAPGQKRKRKGATKLQDFHKWYLDAYAEHPD GRRARRKGPTFADMEVLYWKHVKEQLETLQKLRRRKINERWLPGAKQDLWPTEEDRLEES LEDLGVAADDFLEPEEYVEEPAGVMPEEAADLDAEAMPESLRYEELVRRNVELFIATSQK FIQETELSQRIRDWEDTIQPLLQEQEQHVPFDIHIYGDQLASRFPQLNEWCPFSELVAGQ PAFEVCRSMLASLQLANDYTVEITQQPGLEAAVDTMSLRLLTHQRAHTRFQ
CNDH2_C |
![]() |
---|
PFAM accession number: | PF16858 |
---|---|
Interpro abstract (IPR031737): | This entry represents the C-terminal domain of the H2 subunit of the condensin II complex (Ncaph2), found in eukaryotes but not fungi. Condensin complexes are involved in the restructuring and maintenance of chromatin. Eukaryotes possess two condensins (condensin I and condensin II), each composed of structural maintenance of chromosomes proteins SMC2 and SMC4, with three additional non-SMC condensin-associated proteins (Ncaps) unique to each condensin (condensin I - Ncaph, Ncapd2, and Ncapg; condensin II - Ncaph2, Ncapd3, and Ncapg2) [ (PUBMED:20442714) (PUBMED:22855829) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CNDH2_C