The domain within your query sequence starts at position 4 and ends at position 171; the E-value for the CNRIP1 domain shown below is 5.6e-57.
LPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENIS IGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPVSPSCGCGDMASE QRNCRGRNHYFFTNKERCAGASFYGNRVQFPSWTCEKRERVIFTDAFF
CNRIP1 |
---|
PFAM accession number: | PF15043 |
---|---|
Interpro abstract (IPR029204): | This family of proteins interacts with cannabinoid receptor 1 (CNR1). In humans, there are two isoforms, CRIP1a and CRIP1b. CRIP1a, but not CRIP1b, suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels [ (PUBMED:17895407) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CNRIP1